PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G053200.1.p
Common NameSb03g004600, SORBIDRAFT_03g004600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 281aa    MW: 30207.5 Da    PI: 6.7744
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G053200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-161663148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l+  ++++G  +W++I++  g+ R++k+c++rw +yl
  Sobic.003G053200.1.p 16 KGLWSPEEDERLASHIARFGVSCWSSIPELAGLQRCGKSCRLRWMNYL 63
                          678*******************************************97 PP

2Myb_DNA-binding46.31e-1469111145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           rgr+++ E++l++ ++k lG+  W+ Ia++++ gR+++++k++w+
  Sobic.003G053200.1.p  69 RGRFSQHEEDLIISLHKALGNS-WSQIAARLP-GRSDNEIKNFWN 111
                           89******************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-23866IPR009057Homeodomain-like
PROSITE profilePS5129415.9681163IPR017930Myb domain
SuperFamilySSF466899.38E-2814110IPR009057Homeodomain-like
SMARTSM007172.1E-111565IPR001005SANT/Myb domain
PfamPF002491.1E-141663IPR001005SANT/Myb domain
CDDcd001673.06E-101963No hitNo description
PROSITE profilePS5129422.88964118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2567118IPR009057Homeodomain-like
SMARTSM007172.7E-1468116IPR001005SANT/Myb domain
PfamPF002497.8E-1369111IPR001005SANT/Myb domain
CDDcd001671.06E-971111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRVHPCCSE EKKVRKGLWS PEEDERLASH IARFGVSCWS SIPELAGLQR CGKSCRLRWM  60
NYLRPDLKRG RFSQHEEDLI ISLHKALGNS WSQIAARLPG RSDNEIKNFW NARLRKKLRQ  120
KEASTSSTAV SKEPAARRNQ PNANAEVDDR SKPAPSVFTP FVPDHVAAAA GASGASSCDD  180
SSAAGSFFAD PAAATCAAVH LADGAADDRN AAAAESGVTP TPSLTTSTSA CTDDARGSCD  240
DGFFRAMVDD PSFLFGDFYL DGDAGHHGQI MSFWEGHAFS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271611827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118RLRKKLR
2113119LRKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457273.10.0hypothetical protein SORBIDRAFT_03g004600
TrEMBLC5XNH00.0C5XNH0_SORBI; Putative uncharacterized protein Sb03g004600
STRINGSb03g004600.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144481725
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-61myb domain protein 86